DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and MMD

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_006721858.1 Gene:MMD / 23531 HGNCID:7153 Length:269 Species:Homo sapiens


Alignment Length:300 Identity:68/300 - (22%)
Similarity:109/300 - (36%) Gaps:95/300 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 HRPPL-----PSFRACFKSIFRVHTETGNIWTHLLGCI-AFIGVALYFISRPSVEIQTQEKIVFG 241
            ||.|.     |:   |::       ...|.:||....: |.:|.||  :.|.|.:  ..|||.  
Human    13 HRAPANGRYKPT---CYE-------HAANCYTHAFLIVPAIVGSAL--LHRLSDD--CWEKIT-- 61

  Fly   242 AFFIGAIVCLGF--SFAFHTLS---CHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQP 301
            |:..|..:|..|  |..||.:|   .|...:...|...|...|...|..|:.||.:         
Human    62 AWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWFF--------- 117

  Fly   302 KVIYLSVVSILGILSIVVSLWDKFSEPA--------------LRPLRAGV-----FMSFGLSGVI 347
                    |:..:.:::.:.|.:....|              |.||.:.:     .|:.|.:..:
Human   118 --------SLRFVSNLLPNTWSEIKGQAVLTSFCLIGLNLRELGPLASHMRWFIWLMAAGGTIYV 174

  Fly   348 PAIH--YSIMEGWF-------------SQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKF 397
            ...|  |.::|.:|             |..:...|..|...||:|.||.:.:           |.
Human   175 FLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFF-----------KS 228

  Fly   398 D-IWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSECT 436
            | |...:|.|:|:.|..||.|||:     |:::.:|...|
Human   229 DGIIPFAHAIWHLFVATAAAVHYY-----AIWKYLYRSPT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 58/261 (22%)
MMDXP_006721858.1 hlyIII 27..258 CDD:273425 61/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158505
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.