DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and PAQR7

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_848509.1 Gene:PAQR7 / 164091 HGNCID:23146 Length:346 Species:Homo sapiens


Alignment Length:278 Identity:70/278 - (25%)
Similarity:119/278 - (42%) Gaps:61/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 FLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQE------ 236
            :::.|:||...::|..|:::|:.|.|..|:|||||       .||..:.|.::.::|.:      
Human    46 YIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLL-------AALVLLLRLALFVETVDFWGDPH 103

  Fly   237 -----KIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGF- 295
                 .||..:|     ..|.||...|.|...|......|..|||.|:|:...||.:...||.. 
Human   104 ALPLFIIVLASF-----TYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIE 163

  Fly   296 -YCHYQPKVIYLSVVSILGILSIVVSLWDKF-SEPAL------------------RPLRAGVFMS 340
             ..|.|.:.::|.:.:.|..||.:.|.::|: .:|.|                  .|:...:|:|
Human   164 PAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVS 228

  Fly   341 FGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQ 405
            ...:...||:.|...:..|                 ::|.|..::..:|||||||...::||.||
Human   229 SDPTTDDPALLYHKCQVVF-----------------FLLAAAFFSTFMPERWFPGSCHVFGQGHQ 276

  Fly   406 IFHILVIAAAFVHYHGIS 423
            :|||.::.........::
Human   277 LFHIFLVLCTLAQLEAVA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 65/252 (26%)
PAQR7NP_848509.1 HlyIII 66..290 CDD:281059 65/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158502
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.