DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and Y71G12B.35

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001249029.1 Gene:Y71G12B.35 / 13179386 WormBaseID:WBGene00185098 Length:349 Species:Caenorhabditis elegans


Alignment Length:127 Identity:25/127 - (19%)
Similarity:37/127 - (29%) Gaps:52/127 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PEDSLSPN--DLDILE-YDDELVEEDDAGC--------------------PLP-------STPE- 114
            ||..:..|  .|.:.: |||:..:||:...                    |||       ..|| 
 Worm   136 PEHPIPANIPPLHVAQLYDDDFEQEDEDDLEWLSSQPGGSSSRIPDVPSEPLPRSAGISEKVPEK 200

  Fly   115 ---------------------DTQLIEAEMTEVLKAGVLSDEIDLGALAHNAAEQAEEFVRK 155
                                 .|:.||.|..:..:.|...:.|....:..|...:..|||.|
 Worm   201 QMSTRKIVSRARQIAKSDAQIQTEQIEKERVDTAEIGTNCNIIVTPRVLENDDPRGSEFVEK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239
Y71G12B.35NP_001249029.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.