powered by:
Protein Alignment AdipoR and Y71G12B.35
DIOPT Version :9
Sequence 1: | NP_001247239.1 |
Gene: | AdipoR / 42656 |
FlyBaseID: | FBgn0038984 |
Length: | 444 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001249029.1 |
Gene: | Y71G12B.35 / 13179386 |
WormBaseID: | WBGene00185098 |
Length: | 349 |
Species: | Caenorhabditis elegans |
Alignment Length: | 127 |
Identity: | 25/127 - (19%) |
Similarity: | 37/127 - (29%) |
Gaps: | 52/127 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 PEDSLSPN--DLDILE-YDDELVEEDDAGC--------------------PLP-------STPE- 114
||..:..| .|.:.: |||:..:||:... ||| ..||
Worm 136 PEHPIPANIPPLHVAQLYDDDFEQEDEDDLEWLSSQPGGSSSRIPDVPSEPLPRSAGISEKVPEK 200
Fly 115 ---------------------DTQLIEAEMTEVLKAGVLSDEIDLGALAHNAAEQAEEFVRK 155
.|:.||.|..:..:.|...:.|....:..|...:..|||.|
Worm 201 QMSTRKIVSRARQIAKSDAQIQTEQIEKERVDTAEIGTNCNIIVTPRVLENDDPRGSEFVEK 262
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
AdipoR | NP_001247239.1 |
HlyIII |
198..419 |
CDD:397239 |
|
Y71G12B.35 | NP_001249029.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.