DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and LOC103909971

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_009296615.1 Gene:LOC103909971 / 103909971 -ID:- Length:235 Species:Danio rerio


Alignment Length:249 Identity:64/249 - (25%)
Similarity:95/249 - (38%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 HTETGNIWTHLLGCIAFI--GVALYFISRPSVEIQTQEKIVFGAFFIGAIVCLGF--SFAFHTLS 261
            :....|..||.|..|..|  |:.|||:|....|       ...|:..||.:...|  |..|||:|
Zfish    22 YEHAANCATHALWIIPSIVGGILLYFLSDDHWE-------EISAWLYGAGLSSLFIISTVFHTVS 79

  Fly   262 ---CHSVEMGRLFSKLDYCGIALLIMGSFVPWLY---YGFYCHYQPKVIYLSVVSILGILSIVVS 320
               .|...:...|...|...|...|..|:.|||.   .|.:..:...|::   |...|..:.|..
Zfish    80 WKKSHLRSVEHCFHMCDRMVIYFFIAASYTPWLTLRDLGPWAAHMRWVVW---VMASGGTAYVFF 141

  Fly   321 LWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFSQMSRASLGWLILMGLLYILGALLYA 385
            ..:||....|        :.:...||.||:..      .|...|:.|..|:|.|..|:||...: 
Zfish   142 FHEKFKVVEL--------ICYIAMGVFPALVI------LSMADRSGLCELLLGGGCYVLGMAFF- 191

  Fly   386 LRVPERWFPGKFD-IWGQSHQIFHILVIAAAFVHYHGISEMAMYRVMYSECTVP 438
                      |.| |...:|.|:|:.|...|.:||:     |:::.:|:....|
Zfish   192 ----------KSDGIVPFAHAIWHLFVAMGAGIHYY-----AIWKYLYTPVNQP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 59/228 (26%)
LOC103909971XP_009296615.1 HlyIII 23..223 CDD:296067 62/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.