DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdipoR and paqr5b

DIOPT Version :9

Sequence 1:NP_001247239.1 Gene:AdipoR / 42656 FlyBaseID:FBgn0038984 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001003573.1 Gene:paqr5b / 100007661 ZFINID:ZDB-GENE-040801-92 Length:347 Species:Danio rerio


Alignment Length:293 Identity:79/293 - (26%)
Similarity:122/293 - (41%) Gaps:35/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 KVCHYKNLPKWLQDNDFLHRGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFIS 226
            :|.:...:||...: |.:..|:|.|..|...|..|:|::..||.|:|||.|....|:...:..:.
Zfish     9 RVFNVHQVPKAFHE-DGIISGYRHPRSSATECVWSLFQLTNETLNVWTHFLPTWYFLWKLMTVLL 72

  Fly   227 RPSV--EIQTQEKIVFGAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFV- 288
            ...|  |..|...:||  .|...:..|..|.| ||.|..|.....:....||..::...:||.: 
Zfish    73 MEDVWNEAYTWPLLVF--LFSCCVYPLASSCA-HTFSSMSTRARHICYFFDYGALSFYSLGSAIS 134

  Fly   289 --------PWLYYGFYCHYQPKVIYLSVVSI---------LGILSIVVSLWDKFSE---PAL-RP 332
                    .||...|:.:|....::.:|:|.         |.:|.....:.::|||   |.: :.
Zfish   135 YSAYVFPDAWLSSSFHAYYISVAVFNTVLSTSLACYSRLGLPLLHYSHDIVERFSERQCPRMSKV 199

  Fly   333 LRAGVFMSFGLSGVIPAIH---YSIMEGWFSQMSRASLGWLILMGLLYILGALLYALRVPERWFP 394
            ||...|....|...||..:   ..:.||.....:.:.   .:...||..|.:.|:|..:|||..|
Zfish   200 LRILAFAYPYLFDNIPLFYRLFVCVGEGCTDNEANSV---HVQHTLLAFLTSFLFATHLPERLAP 261

  Fly   395 GKFDIWGQSHQIFHILVIAAAFVHYHGISEMAM 427
            |:||..|.|||:||:..|.........| ||.|
Zfish   262 GRFDYIGHSHQLFHVCAIIGTHFQMKAI-EMDM 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdipoRNP_001247239.1 HlyIII 198..419 CDD:397239 65/247 (26%)
paqr5bNP_001003573.1 HlyIII 44..286 CDD:281059 65/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594444
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1524940at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.