DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and AT1G75000

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_177637.1 Gene:AT1G75000 / 843838 AraportID:AT1G75000 Length:281 Species:Arabidopsis thaliana


Alignment Length:211 Identity:40/211 - (18%)
Similarity:85/211 - (40%) Gaps:55/211 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ELKNTLLVYNAVQ-VLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAV--WLY--YI 124
            |:::|..::...: ..|.|.|.:                       |:..|.:..|  |.|  |:
plant    94 EIRDTRWLWRRTRTTALQWFLCF-----------------------PVGTRASGRVFFWSYAFYL 135

  Fly   125 AKITELLDTVFFVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAY 189
            ::...|..|.|.|:|:  |::||..|.:.:.:...:|:.::| :.....:...:.:..:.::|.|
plant   136 SRFLHLFRTFFSVIRR--RKLSFFQLINQSSLLCISFLWLEY-SQSFQVVAILLTTVSYAVVYGY 197

  Fly   190 YLLSAMG------PKV---QKYLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTF 245
            ...:.:|      |.|   |..|     :..:.:....::.:|.::   :..||   .|.|.| |
plant   198 RFWTEIGLRGACFPFVGNCQAIL-----LGCMTVCHVGVLCIHLVK---RGGCN---GIGAWL-F 250

  Fly   246 NA---GLFTYMFSAFY 258
            |:   .:.|.::..||
plant   251 NSVLNAVITLLYLKFY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 40/211 (19%)
AT1G75000NP_177637.1 ELO 26..276 CDD:395916 40/211 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.