DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and Elovl4

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:271 Identity:111/271 - (40%)
Similarity:160/271 - (59%) Gaps:20/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVRLNETT-------TIVDRMVNFFVEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYM 58
            ||...|:|.       ||.|:           |...|.|..:|.|...|...||.| ::.||::|
Mouse    15 MSTAFNDTVEFYRWTWTIADK-----------RVADWPLMQSPWPTISISTLYLLF-VWLGPKWM 67

  Fly    59 RDRKPFELKNTLLVYNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYY 123
            :||:||:::..|::||...|||:..:|.|.:.|.:...|::.||.|.|.:|...:|:|.|:|.|:
Mouse    68 KDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNDVNEVRIAGALWWYF 132

  Fly   124 IAKITELLDTVFFVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYA 188
            ::|..|.||||||:||||..|:||||:|||..|....:||:|:.|||.......:|||||:|||:
Mouse   133 VSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYS 197

  Fly   189 YYLLSAMGPKVQKYLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYM 253
            ||.|:|.||.:|||||||:|:|:||:|||.:...|| .:....:|.|||.:...|...|..|.::
Mouse   198 YYGLTAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHT-ALSLYTDCPFPKWMHWALIAYAISFIFL 261

  Fly   254 FSAFYVANYKK 264
            |..||...|.:
Mouse   262 FLNFYTRTYNE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 101/230 (44%)
Elovl4NP_683743.2 ELO 41..277 CDD:279492 102/234 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 111/271 (41%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.