DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and ELOVL3

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_689523.1 Gene:ELOVL3 / 83401 HGNCID:18047 Length:270 Species:Homo sapiens


Alignment Length:260 Identity:75/260 - (28%)
Similarity:111/260 - (42%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FFVEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYA-GPRYMRDRKPFELKNTLLVYN------- 74
            ||.|:       |..|      |.|  |.:|..|.| |..||::||.|.|:..|::::       
Human    29 FFEEY-------WATS------FPI--ALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFS 78

  Fly    75 ---AVQV--LLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTV 134
               ||::  ::..||...|.|           |.|.:.:...:..:....|::.::|:.||.||.
Human    79 ILGAVRMWGIMGTVLLTGGLK-----------QTVCFINFIDNSTVKFWSWVFLLSKVIELGDTA 132

  Fly   135 FFVLRKKQRQISFLHLYHHTLMPVCAFIGV--KYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGP 197
            |.:|||  |.:.|:|.|||:.:.|....|.  |..|||....:.|   .:|.|||.||.|.|...
Human   133 FIILRK--RPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNF---GVHAIMYTYYTLKAANV 192

  Fly   198 KVQKYLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTF----NAGLFTYMFSAFY 258
            |..|.|  ...||.|||:|.                 |..:|.::||:    :.|..|.|...|:
Human   193 KPPKML--PMLITSLQILQM-----------------FVGAIVSILTYIWRQDQGCHTTMEHLFW 238

  Fly   259  258
            Human   239  238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 71/247 (29%)
ELOVL3NP_689523.1 ELO 29..266 CDD:307345 75/260 (29%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03203 266..270
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.