DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and ELOVL7

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001098028.1 Gene:ELOVL7 / 79993 HGNCID:26292 Length:281 Species:Homo sapiens


Alignment Length:259 Identity:115/259 - (44%)
Similarity:165/259 - (63%) Gaps:6/259 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVDRMVNFF---VEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLV 72
            :..|.|:.:   ::..|.|.:.|.|.::|.|..::||.|:||....||:.|.:|||||||..::.
Human     6 LTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMIT 70

  Fly    73 YNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFV 137
            ||...||.|..:.||....|||..|:|:|..|.|...|.::||||..||||.:|..|||||:|||
Human    71 YNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFV 135

  Fly   138 LRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKY 202
            ||||..|::|||::|||:||...:.|||:.|||.||....:|:.:|::||:||.|||:||..|||
Human   136 LRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKY 200

  Fly   203 LWWKKYITILQIVQFLIIFVHTLQIQFQPNC--NFPKSIAALLTFNAGLFTYMFSAFYVANYKK 264
            ||||||:|.||:|||:|:.:|..|..|..:|  .||.....:::::. :|..:|..|:...|.|
Human   201 LWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSF-MFLLLFLHFWYRAYTK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 108/232 (47%)
ELOVL7NP_001098028.1 ELO 30..269 CDD:307345 110/235 (47%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.