DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and Elovl1

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001037740.1 Gene:Elovl1 / 679532 RGDID:1587151 Length:279 Species:Rattus norvegicus


Alignment Length:278 Identity:109/278 - (39%)
Similarity:168/278 - (60%) Gaps:15/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDRMVNFFVE---HEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVY 73
            ::.:||.:.|   ..|.|.:.:.|..:|..:..||..|:||.|..|||.|.:||||:|:..::||
  Rat     1 MEAVVNLYQELMKCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVY 65

  Fly    74 NAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFVL 138
            |...|.||..:.||....||...|.::|.||.:.::|.::||.|..||:.::|:.||:|||.|:|
  Rat    66 NFSLVTLSLYIVYEFLMSGWLSTYTWRCDPVDFSNNPEALRMVRVAWLFMLSKVIELMDTVIFIL 130

  Fly   139 RKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYL 203
            |||..|::|||::||:::|...:.|:|...||.|:....|||.:|::||.||.|||:||..|.||
  Rat   131 RKKDGQVTFLHVFHHSVLPWSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYL 195

  Fly   204 WWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAG-LFTYMFSAFYVANYKK--- 264
            ||||::|.:|::||:::.:|..|..|.|:||:...|...|.:..| :|..:||.|:..:|.|   
  Rat   196 WWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFILFSNFWYHSYTKGKR 260

  Fly   265 --------EAAAQAKLAA 274
                    .|||..|:.|
  Rat   261 LPRAVQQNGAAASMKVKA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 97/231 (42%)
Elovl1NP_001037740.1 ELO 23..260 CDD:395916 99/236 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.