DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and ELOVL5

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:283 Identity:102/283 - (36%)
Similarity:144/283 - (50%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWVLFYEG 88
            |.|.|.|||.:...|.|:....|| ..::.||:|||:::||..:..|:|||....|||..:|.|.
Human    20 DTRVKGWFLLDNYIPTFICSVIYL-LIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCES 83

  Fly    89 YK---------------------------GGWGGHYNFKCQ--PVTYESDPISMRMARAVWLYYI 124
            .:                           |.|.|.|||.||  ....|||   |::.|.:|.||.
Human    84 KREQPRRSACASRTDPSTQQQLPENRLVTGVWEGKYNFFCQGTRTAGESD---MKIIRVLWWYYF 145

  Fly   125 AKITELLDTVFFVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAY 189
            :|:.|.:||.||:|||...||:.||:|||..|....:..:.:...||......:|||||::||:|
Human   146 SKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSY 210

  Fly   190 YLLSAMGPKVQKYLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYM- 253
            |.||:: |.::.|||||||||..|::||::..:.|......| |.||   ...|.|..|   || 
Human   211 YGLSSV-PSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWP-CTFP---LGWLYFQIG---YMI 267

  Fly   254 -----FSAFYVANYKKEAAAQAK 271
                 |:.||:..|.|:.|::.|
Human   268 SLIALFTNFYIQTYNKKGASRRK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 94/265 (35%)
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 97/272 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.