DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and elovl6

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001017257.2 Gene:elovl6 / 550011 XenbaseID:XB-GENE-942876 Length:265 Species:Xenopus tropicalis


Alignment Length:274 Identity:75/274 - (27%)
Similarity:121/274 - (44%) Gaps:50/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FVEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLL----------VY 73
            |.|:|.:   ||...|.. ..|:....|..| ::.|...|:.|:.|||:..|:          ::
 Frog    17 FNENEAI---QWMQENWK-KSFLFSALYAAF-IFGGRHLMKQREKFELRKPLILWSLSLAVFSIF 76

  Fly    74 NAVQ--VLLSWVLFYEGYKGGWGGHYNFKCQPVTYES---DPISMRMARAVWLYYIAKITELLDT 133
            .||:  ..:.::|..:|.|           |.|..:|   .|:|...|.|   :.::|..||.||
 Frog    77 GAVRTGAYMLYILMTKGLK-----------QSVCDQSFYYGPVSKFWAYA---FVLSKAPELGDT 127

  Fly   134 VFFVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPK 198
            :|.:|||  :::.|||.|||..:.:.::...|....|.|..: .:|..:|.:||:||.|.|.|.:
 Frog   128 IFIILRK--QKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFM-TMNYGVHAVMYSYYALRAAGFR 189

  Fly   199 VQKYLWWKKYITILQIVQFLI-IFVHTLQIQFQPNCNFP--------KSIAALLTFNAGLFTYMF 254
            |.:.  :...||:.||.|.:| ..|:.|...:......|        .||..|..|  .||.:.|
 Frog   190 VSRK--FAMLITLSQITQMIIGCVVNYLVFSWMQQGQCPSHVQNIVWSSIMYLSYF--VLFCHFF 250

  Fly   255 SAFYVANYKKEAAA 268
            ...|:...:|.:.|
 Frog   251 FEAYITKTRKASKA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 68/254 (27%)
elovl6NP_001017257.2 ELO 25..262 CDD:366492 70/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.