DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and elovl1

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001016644.1 Gene:elovl1 / 549398 XenbaseID:XB-GENE-1014374 Length:290 Species:Xenopus tropicalis


Alignment Length:247 Identity:107/247 - (43%)
Similarity:154/247 - (62%) Gaps:1/247 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FVEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWV 83
            |::..|.|...:.|..:|.....||.:|:||.|..|||.|.:||||:||..::|||...|.||..
 Frog    15 FMKGADSRIYDYPLMQSPFLPGAILLSYVYFVLSLGPRIMANRKPFDLKPLMVVYNFSLVALSAY 79

  Fly    84 LFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFVLRKKQRQISFL 148
            :.||....||...|.::|.||.....|:::||.|..||:..:|..|||||||||:|||..||:||
 Frog    80 IVYEFLMSGWLTGYTWRCDPVDVSDTPMALRMVRVAWLFLFSKFIELLDTVFFVVRKKNSQITFL 144

  Fly   149 HLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITILQ 213
            |::||:::|...:.|||:..||.|:....|||.:|:|||.||.|||.||:.||||||||::|.:|
 Frog   145 HIFHHSVLPWSWWWGVKFGPGGMGSFHAMINSLVHVIMYFYYGLSAAGPRFQKYLWWKKHMTAIQ 209

  Fly   214 IVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAG-LFTYMFSAFYVANYKK 264
            ::||:::.:|..|..|..:|::...|...|.:..| :|..:||.|:...|.|
 Frog   210 LIQFVLVSIHISQYYFMSSCDYQYPIFIHLIWIYGTVFFILFSNFWYQAYTK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 102/231 (44%)
elovl1NP_001016644.1 ELO 27..267 CDD:395916 104/235 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.