DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and ELOVL2

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_011513018.1 Gene:ELOVL2 / 54898 HGNCID:14416 Length:326 Species:Homo sapiens


Alignment Length:261 Identity:99/261 - (37%)
Similarity:147/261 - (56%) Gaps:16/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DRMVNFFVEH----EDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVY 73
            |..:|.|:::    .|.|.:.||:.::..|.|.:...|| ..::.|.:||::|....|:..|.:|
Human    38 DDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYL-LSIWLGNKYMKNRPALSLRGILTLY 101

  Fly    74 NAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTY--ESDPISMRMARAVWLYYIAKITELLDTVFF 136
            |....|||..:..|.....|.|.||.:||.:|.  |:|   :|:|:.:|.||.:|..|.|||:||
Human   102 NLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEAD---IRVAKVLWWYYFSKSVEFLDTIFF 163

  Fly   137 VLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQK 201
            |||||..||:|||:|||..|....:..:.:...|.......:||||||:||:||.||.. |.:.|
Human   164 VLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVF-PSMHK 227

  Fly   202 YLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFT--YMFSAFYVANYKK 264
            |||||||:|..|:|||::...||:....:| |.||  ...|:..::.:.|  .:|..|||..|:|
Human   228 YLWWKKYLTQAQLVQFVLTITHTMSAVVKP-CGFP--FGCLIFQSSYMLTLVILFLNFYVQTYRK 289

  Fly   265 E 265
            :
Human   290 K 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 91/234 (39%)
ELOVL2XP_011513018.1 ELO 60..294 CDD:279492 93/239 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.