DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and elovl2

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001016159.1 Gene:elovl2 / 548913 XenbaseID:XB-GENE-489753 Length:296 Species:Xenopus tropicalis


Alignment Length:265 Identity:106/265 - (40%)
Similarity:151/265 - (56%) Gaps:24/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VDRMVNFFVEH----EDLRTKQWFLSNAPGP-LFMILGAYLYF-CLYAGPRYMRDRKPFELKNTL 70
            :|:.||.||::    .|.||:.|.:.::..| ||:.|   ||| .::.|.:||::|..|.|:..|
 Frog     7 IDQEVNAFVDYLFGPRDTRTRGWLMLDSYLPTLFLTL---LYFLSIWLGTKYMQNRPAFSLRGHL 68

  Fly    71 LVYNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVF 135
            :|||.|..|||..:..|.....|.|.||.:||.:. .:....:|:|:.:|.||.:|..|.:||:|
 Frog    69 IVYNLVVTLLSLYMLIELILSTWEGGYNLQCQNLD-SAGKADVRVAKVLWWYYFSKAIEFMDTIF 132

  Fly   136 FVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQ 200
            ||||||..||:|||:|||..|....:..:.:...|.......:|||||::||:||.||.: |.:.
 Frog   133 FVLRKKNSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHVLMYSYYGLSVI-PSMH 196

  Fly   201 KYLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYM------FSAFYV 259
            ||||||:|:|..|:||||:...|||....:| |.||   ...|.|.|   :||      |..||:
 Frog   197 KYLWWKRYLTQAQLVQFLLTITHTLSAAVKP-CGFP---FGCLMFQA---SYMATLVILFVNFYL 254

  Fly   260 ANYKK 264
            ..|||
 Frog   255 KTYKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 94/238 (39%)
elovl2NP_001016159.1 ELO 49..263 CDD:366492 90/220 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.