DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and Elovl2

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_062296.1 Gene:Elovl2 / 54326 MGIID:1858960 Length:292 Species:Mus musculus


Alignment Length:273 Identity:103/273 - (37%)
Similarity:150/273 - (54%) Gaps:23/273 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DRMVNFFVEH----EDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVY 73
            |..||.|:::    .|.|.:.|||.::..|.|::...|| ..::.|.:||::|....|:..|.:|
Mouse     8 DNEVNAFLDNMFGPRDSRVRGWFLLDSYLPTFILTITYL-LSIWLGNKYMKNRPALSLRGILTLY 71

  Fly    74 NAVQVLLSWVLFYEGYKGGWGGHYNFKCQPV--TYESDPISMRMARAVWLYYIAKITELLDTVFF 136
            |....|||..:..|.....|.|.||.:||.:  ..|.|   :|:|:.:|.||.:|:.|.|||:||
Mouse    72 NLAITLLSAYMLVELILSSWEGGYNLQCQNLDSAGEGD---VRVAKVLWWYYFSKLVEFLDTIFF 133

  Fly   137 VLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQK 201
            |||||..||:|||:|||..|....:..:.:...|.......:||||||:||:||.||.. |.:.|
Mouse   134 VLRKKTNQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVF-PSMHK 197

  Fly   202 YLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFT--YMFSAFYVANYKK 264
            |||||||:|..|:|||::...|||....:| |.||  ...|:..::.:.|  .:|..||:..|:|
Mouse   198 YLWWKKYLTQAQLVQFVLTITHTLSAVVKP-CGFP--FGCLIFQSSYMMTLVILFLNFYIQTYRK 259

  Fly   265 EAAAQAKLAAKKE 277
            :       ..|||
Mouse   260 K-------PVKKE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 91/234 (39%)
Elovl2NP_062296.1 ELO 30..264 CDD:307345 93/248 (38%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03202 289..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.