DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and elovl5

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001011248.1 Gene:elovl5 / 496694 XenbaseID:XB-GENE-952346 Length:295 Species:Xenopus tropicalis


Alignment Length:267 Identity:98/267 - (36%)
Similarity:147/267 - (55%) Gaps:12/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVDRMVNFFVEH----EDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLL 71
            ::|:.||.:::|    :|.|.:.|.|.:...|..:....|| |.::.||:||::|.|...:..|:
 Frog     3 VLDKAVNGYIDHLLGPKDPRVRGWLLLDNYVPTILFTALYL-FIVWRGPKYMQNRPPVSCRGILV 66

  Fly    72 VYNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFF 136
            |||....|||..:|||...|.|.|.|||.||......| ...::.|.:|.||.:|:.|.:||.||
 Frog    67 VYNLGLTLLSLYMFYELVTGVWEGGYNFFCQDTNSGGD-ADTKIVRVLWWYYFSKLIEFMDTFFF 130

  Fly   137 VLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQK 201
            :|||...||:.||:|||..|....:..:.:...||......:|||||::||:||.|||: |.::.
 Frog   131 ILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSAI-PAMRP 194

  Fly   202 YLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFT--YMFSAFYVANYKK 264
            |||||||||..|:.||::....|......| |.||  :..|...|..:.:  .:|..||:..|.|
 Frog   195 YLWWKKYITQCQLTQFVLTMTQTTCAMIWP-CKFP--MGWLYFQNCYMISLIILFGNFYIKTYNK 256

  Fly   265 EAAAQAK 271
            :.:::.|
 Frog   257 KTSSRRK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 88/232 (38%)
elovl5NP_001011248.1 ELO 28..261 CDD:366492 90/238 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.