DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and Baldspot

DIOPT Version :10

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_001237830.3 Gene:Baldspot / 4576681 VectorBaseID:AGAMI1_012789 Length:315 Species:Anopheles gambiae


Alignment Length:47 Identity:12/47 - (25%)
Similarity:22/47 - (46%) Gaps:7/47 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DGEVVFGVAHIYASFNDTFVHVTDLSG-KETISRVTGGMKVKADRDE 69
            |....|.:.|||      |.::.|:.. .::...:.||::..||:.|
Mosquito   190 DESEFFDLLHIY------FPNIFDIKYLMKSCKNLKGGLQEVADQLE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 30..262 CDD:460083 10/41 (24%)
BaldspotXP_001237830.3 None

Return to query results.
Submit another query.