DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and CG6660

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_651104.1 Gene:CG6660 / 42708 FlyBaseID:FBgn0039030 Length:272 Species:Drosophila melanogaster


Alignment Length:270 Identity:106/270 - (39%)
Similarity:154/270 - (57%) Gaps:21/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NFFVEHEDLRTKQWFLSNAP--GPLFMIL---GAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAV 76
            :.:.||.|.|     :::.|  |.|:::|   ..|:.|.|:.|||:|.:|.|||||..:.|||.|
  Fly    11 DLYAEHGDPR-----VAHLPLLGNLWIVLAIVALYVAFVLHYGPRWMANRAPFELKRVMQVYNVV 70

  Fly    77 QVLLSWVLFYEGYKGGW---GGHYNFKCQPVTY-ESDPISMRMARAVWLYYIAKITELLDTVFFV 137
            |||.:..:|..|....:   |  |::.||||.: :..|..|:...|.:.||:.|..:||||||.|
  Fly    71 QVLANATIFVIGLSNTYLQPG--YSWTCQPVDHTDRSPAMMKTLYASYAYYMLKYLDLLDTVFIV 133

  Fly   138 LRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKY 202
            ||||..|:||||:|||..|.....|.:.:..|.|.::||.||..:|.:|||||..:::| .|:..
  Fly   134 LRKKNSQVSFLHVYHHGGMVFGVSIFMTFLGGSHCSMLGIINLLVHTVMYAYYYAASLG-AVKNL 197

  Fly   203 LWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTY-MFSAFYVANY--KK 264
            ||||:.||.||::||..:..|.|.:..:..|.||..| |.:.|...:|.: ||..||...|  |:
  Fly   198 LWWKQRITQLQLMQFGYLTFHFLLVIVRNPCQFPVFI-AFIGFIQNIFMFSMFFDFYCKTYIRKQ 261

  Fly   265 EAAAQAKLAA 274
            ..:|:.||.|
  Fly   262 RKSAEHKLKA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 96/240 (40%)
CG6660NP_651104.1 ELO 25..265 CDD:279492 98/243 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449609
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.