DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and CG9458

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster


Alignment Length:257 Identity:95/257 - (36%)
Similarity:141/257 - (54%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FLSNAP------------GPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWV 83
            ||..:|            .|:.|:|..||:|...|||:.||:||||:|:..:..||.:|::.:.:
  Fly     8 FLGKSPPDPVRLPLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVI 72

  Fly    84 LFYEGYKGGWG-GHYNFKC--------QPVTYESDPISMRMARAVWL---YYIAKITELLDTVFF 136
            :.:.......| |.|||||        :..|:|.           ||   |:..|:.:||:||||
  Fly    73 MCFFAVHFMLGPGDYNFKCIKNLPPDHEYKTWER-----------WLTYSYFFNKLLDLLETVFF 126

  Fly   137 VLRKKQRQISFLHLYHHTLMPVCAFIGVKYFA-GGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQ 200
            |||||.|||||||::||..|...:|:.:.|:. ||||..:.|.|..:||:||:||..|::....:
  Fly   127 VLRKKDRQISFLHVFHHMYMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSK 191

  Fly   201 KYLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYMFSAFYVANY 262
            ..|||||||||:|::||.|:..|::....||:|...:..|......:.:|..:||.||...|
  Fly   192 GDLWWKKYITIVQLIQFGIVLGHSIYTLKQPDCPSARFSATCAGSISVVFIILFSNFYFHAY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 94/255 (37%)
CG9458NP_731419.1 ELO 20..261 CDD:279492 92/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449606
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.