DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and CG9459

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649958.2 Gene:CG9459 / 41213 FlyBaseID:FBgn0037764 Length:265 Species:Drosophila melanogaster


Alignment Length:248 Identity:94/248 - (37%)
Similarity:138/248 - (55%) Gaps:17/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWVLFYEGYKGGWG-G 95
            |:::..|:..|||.||.|....||.:|:::||:.|...:.:||.||:..:.:|.........| |
  Fly    21 LTSSHWPVLTILGIYLVFIKIVGPWFMQNQKPYNLDRAIKIYNIVQIAYNVILLIFSVHFMLGPG 85

  Fly    96 HYNFKC---QPVTYESDPISMRMARAVWL---YYIAKITELLDTVFFVLRKKQRQISFLHLYHHT 154
            :|||.|   .|:.:|......      ||   |:..|:.:||:||||:.|||.|||||||::||.
  Fly    86 NYNFSCISNLPLDHEYKNWER------WLSYSYFFNKLMDLLETVFFIFRKKYRQISFLHVFHHV 144

  Fly   155 LMPVCAFIGVKYFA-GGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITILQIVQFL 218
            .|....|:.:.|:. ||||..|...|..:|.:||.||..|::.......||||||||::|:|||:
  Fly   145 YMVYIGFLYMYYYGYGGHGFFLITFNVVVHTMMYTYYYQSSLNRNSGGDLWWKKYITVVQLVQFV 209

  Fly   219 IIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYMFSAFYVANY---KKEAAA 268
            |||.|::.|..|.:|...:..|...:..:.:|..:||.|||..|   ||..:|
  Fly   210 IIFSHSVYILRQTDCQTSRLSATWGSLISVVFIILFSNFYVRTYILPKKTKSA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 90/237 (38%)
CG9459NP_649958.2 ELO 20..261 CDD:279492 93/245 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449610
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.