DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and CG16904

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster


Alignment Length:242 Identity:86/242 - (35%)
Similarity:137/242 - (56%) Gaps:16/242 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWVLFYEGYKGGWGGH-------YN 98
            :|:..||.|.|..|.:.|...:..:|:..|..||..|||.:.|:|.      ||.|       ||
  Fly    26 IIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFV------WGIHLLFVQKPYN 84

  Fly    99 FKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFVLRKKQRQISFLHLYHHTLMPVCAFIG 163
            ..|..|..:...:........::|::.|:.:|:||:|||||||||||:|||::||..|...:.:.
  Fly    85 LSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHVFMVFTSHML 149

  Fly   164 VKYFA-GGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITILQIVQFLIIFVHTLQI 227
            ::::. |||..|:...|..:||:||.||..|:....||:.||||||:|:.|:||||::|:|.:..
  Fly   150 IRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFLLMFLHCMYT 214

  Fly   228 QFQPNCNFPKSIAALLTFNAGLFTYMFSAFYVANY--KKEAAAQAKL 272
            .|||||:..:.:..:::..:.....||:.||:..|  .||..::.|:
  Fly   215 YFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIRPKEVKSKGKV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 82/228 (36%)
CG16904NP_649957.1 ELO 16..257 CDD:279492 85/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449607
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.