DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and eloF

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster


Alignment Length:245 Identity:101/245 - (41%)
Similarity:131/245 - (53%) Gaps:36/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYE-SD 109
            ||.|.|..||:.|..||||.|...:.:||..|:|      |.|.....|.|:.|..:  .|: |.
  Fly    26 YLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQIL------YNGLILVLGVHFLFVLK--AYQISC 82

  Fly   110 PISMRM-------ARAV-WLYYIAKITELLDTVFFVLRKKQRQISFLHLYHHTLMPVCAFIGVKY 166
            .:|:.|       .|.: .||.:.|..:|::|:|||||||.|||||||::||..|   ||.|..|
  Fly    83 IVSLPMDHKYKDRERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAM---AFFGYLY 144

  Fly   167 FA----GGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITILQIVQFLIIFVHTLQI 227
            :.    ||.......:|:.:|:||||||.||::..:||:.|||||||||.|:|||.||.:|....
  Fly   145 YCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQFAIILLHCTIT 209

  Fly   228 QFQPNC--NFPKSIAALLTFNAG----LFTYMFSAFYVANYKKEAAAQAK 271
            ..||||  |.|      ||:..|    .|..:||.||..||.|.....||
  Fly   210 LAQPNCAVNRP------LTYGCGSLSAFFAVIFSQFYYHNYIKPGKKSAK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 96/234 (41%)
eloFNP_649956.1 ELO 11..252 CDD:279492 99/242 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449612
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.