DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and elovl4a

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_957090.1 Gene:elovl4a / 393769 ZFINID:ZDB-GENE-040426-1767 Length:309 Species:Danio rerio


Alignment Length:258 Identity:111/258 - (43%)
Similarity:165/258 - (63%) Gaps:5/258 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVDRMVNFF---VEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLV 72
            |::..|:|:   :...|.|.::|.|.::|.|...|..:||.| |:.||:||:.|:||:|:.||::
Zfish     7 IINDTVHFYKWSLTIADKRVEKWPLMDSPLPTLAISSSYLLF-LWLGPKYMQGREPFQLRKTLII 70

  Fly    73 YNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFV 137
            ||...|:|::.:|.|.:......:|::.||||.|..||..:|:|.|:|.|:|:|..|.||||||:
Zfish    71 YNFSMVILNFFIFKELFLAARAANYSYICQPVDYSDDPNEVRVAAALWWYFISKGVEYLDTVFFI 135

  Fly   138 LRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKY 202
            ||||..||||||:|||..|....:||:|:.|||.......:|:.||::||.||.|:|.|||:||:
Zfish   136 LRKKFNQISFLHVYHHCTMFTLWWIGIKWVAGGQSFFGAHMNAAIHVLMYLYYGLAAFGPKIQKF 200

  Fly   203 LWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYMFSAFYVANYKKE 265
            ||||||:||:|:|||.:...|| .:....:|.|||.:...|...|..|..:|..||...|:::
Zfish   201 LWWKKYLTIIQMVQFHVTIGHT-ALSLYSDCPFPKWMHWCLIGYALTFIILFGNFYYQTYRRQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 104/230 (45%)
elovl4aNP_957090.1 ELO 30..267 CDD:279492 105/235 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.