DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and Elovl7

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001178773.1 Gene:Elovl7 / 361895 RGDID:1310560 Length:281 Species:Rattus norvegicus


Alignment Length:258 Identity:115/258 - (44%)
Similarity:160/258 - (62%) Gaps:4/258 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IVDRMVNFF---VEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLV 72
            :..|.|.|:   ::..|.|.:.|.|.::|.|..:|||.|:||....||:.|.:|||||||..::.
  Rat     6 LTSRTVRFYDNWIKDADPRVENWLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMIT 70

  Fly    73 YNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFV 137
            ||...||.|..:.||....|||..|:|:|..|.|...|.:|||....||||.:|..||.||:|||
  Rat    71 YNFFIVLFSVYMCYEFVMSGWGTGYSFRCDIVDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFV 135

  Fly   138 LRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKY 202
            ||||..|::|||::|||:||...:.|||:.|||.||....:|:.:|::||.||.|.||||..|||
  Rat   136 LRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKY 200

  Fly   203 LWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAG-LFTYMFSAFYVANYKK 264
            |||||::|.||:|||:::.||..||.|..:||:...:...:..:.| :|..:|..|:...|.|
  Rat   201 LWWKKHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 107/231 (46%)
Elovl7NP_001178773.1 ELO 30..269 CDD:395916 109/234 (47%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.