DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and elovl7a

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_956169.1 Gene:elovl7a / 334217 ZFINID:ZDB-GENE-030131-6149 Length:288 Species:Danio rerio


Alignment Length:259 Identity:113/259 - (43%)
Similarity:161/259 - (62%) Gaps:1/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ETTTIVDRMVNFFVEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLL 71
            |.|:...::.:.::|..|.|||.|.|.:.|.|..:|:..|:||.:..||:.|.:||||:||..|:
Zfish     5 EFTSTAVQLFDKWMESSDPRTKGWLLMSNPIPQMLIIVFYIYFVISLGPKIMENRKPFDLKRVLI 69

  Fly    72 VYNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFF 136
            |||...|.||..:.||....|||..|.|.|..|.|...|.:||||...||||.:|...:||||||
Zfish    70 VYNIFVVSLSVYMCYEFLMAGWGTGYTFGCDLVDYSQSPKAMRMASVCWLYYFSKFIVMLDTVFF 134

  Fly   137 VLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQK 201
            |||||.:||:|||::||::||...:.||::..||.||....:|..:|:|||.||||||:||..|:
Zfish   135 VLRKKPKQITFLHVFHHSIMPFTWWFGVRFSPGGLGTFHALLNCIVHVIMYTYYLLSALGPSFQR 199

  Fly   202 YLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAG-LFTYMFSAFYVANYKK 264
            :|||||::|.||::||:::.||..|..|..:|.:|..:...:....| :|..:|..|:...|.|
Zfish   200 FLWWKKHLTSLQLIQFVLVTVHISQYFFMKDCPYPYPLFMYIIALYGIIFLLLFLNFWHHAYTK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 103/231 (45%)
elovl7aNP_956169.1 ELO 30..269 CDD:279492 105/234 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.