DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and CG31523

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:252 Identity:116/252 - (46%)
Similarity:160/252 - (63%) Gaps:2/252 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWVLFYEG 88
            |.|...:||.::|.|...:...|.||....|||.|..|||.||::.|:||||:|.:.|..:|||.
  Fly    21 DPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEY 85

  Fly    89 YKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFVLRKKQRQISFLHLYHH 153
            ...||.|||:.|||||.|.:..::|||....|.|||:|.||..||:||:||||...:|.||:.||
  Fly    86 LMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHH 150

  Fly   154 TLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITILQIVQFL 218
            ..||...::|:|:..|||.|....:|||:||:||.||:::|||||.|||:|||||:|..|:|||:
  Fly   151 GCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFV 215

  Fly   219 IIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYMFSAFYVANYKKEAAAQAKLAAK 275
            .||.|..|:.|: .|::||.....:..:..:|.::||.||.|.| ..||.:.:.|.|
  Fly   216 AIFTHQFQLLFR-ECDYPKGFMVWIGLHGVMFLFLFSDFYKAKY-LNAARRRRQAVK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 109/230 (47%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 112/238 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449651
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.