DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and Elovl4

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:263 Identity:110/263 - (41%)
Similarity:161/263 - (61%) Gaps:5/263 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LNETTTIVDRMVNFF---VEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFEL 66
            ||..:|..:..|.|:   ....|.|.:.|.|..:|.|...|...||.| ::.||::|:||:||::
  Rat    12 LNAVSTAFNDTVEFYRWTWSIADKRVEDWPLMQSPWPTLSISTLYLLF-VWLGPKWMKDREPFQM 75

  Fly    67 KNTLLVYNAVQVLLSWVLFYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELL 131
            :..|::||...|||:..:|.|.:.|.:...|::.||.|.|.:|...:|:|.|:|.|:::|..|.|
  Rat    76 RLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNDVNEVRIAAALWWYFVSKGVEYL 140

  Fly   132 DTVFFVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMG 196
            |||||:||||..|:||||:|||..|....:||:|:.|||.......:|||||:|||:||.|:|.|
  Rat   141 DTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFG 205

  Fly   197 PKVQKYLWWKKYITILQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYMFSAFYVAN 261
            |.:|||||||:|:|:||:|||.:...|| .:....:|.|||.:...|...|..|.::|..||...
  Rat   206 PWIQKYLWWKRYLTMLQLVQFHVTIGHT-ALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYTRT 269

  Fly   262 YKK 264
            |.:
  Rat   270 YNE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 101/230 (44%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 102/234 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.