DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and elo-8

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001255110.1 Gene:elo-8 / 259739 WormBaseID:WBGene00001246 Length:292 Species:Caenorhabditis elegans


Alignment Length:254 Identity:64/254 - (25%)
Similarity:111/254 - (43%) Gaps:38/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAV-QVLLSWVLFYE--- 87
            |..|.|.    |:.::...|::......|.::.||.  .||. ...||.| |:.|..::..|   
 Worm    10 TINWSLL----PIHLLGIFYVFVAFNFRPSHISDRS--YLKE-WYYYNCVFQLGLGILMIPEILT 67

  Fly    88 GYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFVLRKKQRQISFLHLYH 152
            ....||  ||:. |...|..:...|..:. |:|.:  .|:.:||:|: .:|...:|.:: :|:.|
 Worm    68 SSLSGW--HYSV-CHSGTLYTGFFSGSVV-AIWTF--TKVVDLLETM-LLLYDARRPLT-IHIIH 124

  Fly   153 HTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITIL--QIV 215
            |.|....||.........|..:: |.|...|:.:|||  ||  |.|:.. .|...::.:.  |::
 Worm   125 HFLSLSFAFTFYSQNFALHRWIV-FFNLTAHVFLYAY--LS--GFKILN-RWTPCWVAVCSSQML 183

  Fly   216 QFLIIFVHTL----QIQFQPNCNFPKSIAALLTFNAGL--FTYMFSAFY---VANYKKE 265
            |.::.|:.|.    ::.....|:  .:...|||...||  ...:|:.||   |..::|:
 Worm   184 QLILPFIATFSAAAKLARGTRCD--ANALGLLTLQIGLGVLIILFAEFYWSRVQAFRKK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 61/245 (25%)
elo-8NP_001255110.1 ELO 14..243 CDD:295675 62/250 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.