DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and SPAC1639.01c

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_592859.3 Gene:SPAC1639.01c / 2543177 PomBaseID:SPAC1639.01c Length:365 Species:Schizosaccharomyces pombe


Alignment Length:270 Identity:90/270 - (33%)
Similarity:124/270 - (45%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYN----AVQVLLSWVLFYEG----Y 89
            |:||....:|:..||  .:..|.|.||:|:|..|:.....||    ....:|:.::|.:.    |
pombe    70 SSAPVVATIIISYYL--LILVGGRIMRNRQPIRLQKIFQYYNLTFSIASAILALLIFEQVAPAIY 132

  Fly    90 KGGWGGHYNFKCQPVTYESDPISMRMARAVWLY---YIAKITELLDTVFFVLRKKQRQISFLHLY 151
            |.|:   :...|....: :.|:       |:||   ||:|..||.||.|.|||||..|  |||.|
pombe   133 KHGF---FFSICNEKAW-TQPL-------VFLYYCAYISKFLELTDTFFLVLRKKPLQ--FLHCY 184

  Fly   152 HHTLMPVCAFIGVKYFAGGHGT---LLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITILQ 213
            ||....|..:..:.    |..:   |:..||..:|:.||.||.|.|.|.:|.    |||::|..|
pombe   185 HHGATAVLVYTQIV----GRTSISWLIIEINLLVHVTMYYYYYLVAKGIRVP----WKKWVTRFQ 241

  Fly   214 IVQF-----LIIF-VHT---LQIQFQPNCNFPKSIAALLTFNAGLFT-----YMFSAFYVANYKK 264
            ||||     .|.| |:|   .:::|...|....|...|..| .||.|     .:|..||...|||
pombe   242 IVQFFADLGFIYFAVYTEVAYRLKFYKACMGHCSGHPLAAF-CGLATISSYLVLFIVFYHNTYKK 305

  Fly   265 EAAAQAKLAA 274
            .||.:.|..|
pombe   306 NAALKMKAKA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 83/256 (32%)
SPAC1639.01cNP_592859.3 ELO 69..303 CDD:279492 83/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.