DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and SPAC1B2.03c

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_593930.1 Gene:SPAC1B2.03c / 2542505 PomBaseID:SPAC1B2.03c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:276 Identity:79/276 - (28%)
Similarity:132/276 - (47%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKP------FELKNTLL--VYNAVQVLLSWVLF 85
            ||      ..:.:.:.|| |..:.:|...|.:|||      |:|.|.:|  :..|:..||...:|
pombe    54 QW------SSVIVSITAY-YVIILSGRAIMTNRKPLKQRRLFQLHNFILTIISGALLALLVEEVF 111

  Fly    86 YEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFVLRKKQRQISFLHL 150
            ....:.|.     |.|   ..:|...:.|:....:|.|:.|..||:||||..|:||  .::|||.
pombe   112 RNYMRNGL-----FYC---VCDSRHFTQRLVTLYYLNYLTKYLELMDTVFLFLKKK--PLAFLHC 166

  Fly   151 YHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITILQIV 215
            |||.:..:..|..:.........::| :|.::|:|||:||.|:|.|.:|    |||:::|.:||:
pombe   167 YHHGITALLCFTQLLGRTSVQWGVIG-LNLYVHVIMYSYYFLAACGRRV----WWKQWVTRVQII 226

  Fly   216 QFLI--------IFVHTLQIQFQP------NCNFPKSIAALLTFNAGL---FTYMFSAFYVANYK 263
            ||::        .:.| :..::.|      :|:  .|:.|.. |..|:   :.::|..||:..|.
pombe   227 QFVLDLILCYFGTYSH-IAFRYFPWLPHVGDCS--GSLFAAF-FGCGVLSSYLFLFIGFYINTYI 287

  Fly   264 KEAAA--QAKLAAKKE 277
            |..|.  |.|.|.|.:
pombe   288 KRGAKKNQRKAAGKAD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 70/255 (27%)
SPAC1B2.03cNP_593930.1 ELO 50..294 CDD:279492 75/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.