DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and CG30008

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster


Alignment Length:256 Identity:93/256 - (36%)
Similarity:135/256 - (52%) Gaps:45/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NAP----GPLFMI--LGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVL-----LSWVLFYE 87
            |.|    .|.:||  |..||||...|||.:|..|||:|||..:|::|.:||:     :..||:..
  Fly    14 NVPTIYKDPWYMITVLVLYLYFVTKAGPHFMEWRKPYELKRLILLHNFIQVVSCIYAIKEVLYIT 78

  Fly    88 GYKGGWGGHYNF-KCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFVLRKKQRQISFLHLY 151
            .     ...|.| ||:.:....:.:......|.:|::: ||:||::||.|||||||.|:|.||::
  Fly    79 D-----NTIYIFWKCRDIGSSPELVRRYYNLAYFLFWL-KISELIETVIFVLRKKQNQVSKLHIF 137

  Fly   152 HH--TLMPVCAFI------GVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPK--VQKYLWWK 206
            ||  |:..|.|.|      ...||.       .|:||.:|:|||:||.::|:..|  ||.....|
  Fly   138 HHFSTVTLVYALINFNENGSAAYFC-------VFLNSIVHVIMYSYYFVAAVADKTLVQALTPVK 195

  Fly   207 KYITILQIVQFLIIFVHTLQIQFQ-PNCNFPKSIAALLTFNA---GLFTYMFSAFYVANYK 263
            |.||::|:.||::|..   |:.|| ..|..|..:  ||.|..   |:| |.|..||.:.|:
  Fly   196 KCITVIQMTQFVLILT---QVAFQLVLCGMPPLV--LLYFTTVILGMF-YGFYDFYNSAYQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 92/253 (36%)
CG30008NP_724853.1 ELO 20..257 CDD:279492 91/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449605
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.900

Return to query results.
Submit another query.