DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and elo-1

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_501689.1 Gene:elo-1 / 177787 WormBaseID:WBGene00001239 Length:288 Species:Caenorhabditis elegans


Alignment Length:279 Identity:77/279 - (27%)
Similarity:119/279 - (42%) Gaps:81/279 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FFVEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPR-YMRDRKPFELKNTLLVYN------- 74
            ||.:|.|:               .|..:.||..:..|.: :||:|:||:|...|.::|       
 Worm    39 FFADHFDV---------------TIQASILYMVVVFGTKWFMRNRQPFQLTIPLNIWNFILAAFS 88

  Fly    75 ---AVQ-------------VLLSWVL---FYEGYKGGWGGHYNFKCQPVTYESDPISMRMARAVW 120
               ||:             ::.|:..   |.:|..|.|                         ||
 Worm    89 IAGAVKMTPEFFGTIANKGIVASYCKVFDFTKGENGYW-------------------------VW 128

  Fly   121 LYYIAKITELLDTVFFVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAG--GHGTLLGFINSFIH 183
            |:..:|:.||:||:|.||||  |.:.|||.|||.|..:.|:.......|  .:|..|.|:   :|
 Worm   129 LFMASKLFELVDTIFLVLRK--RPLMFLHWYHHILTMIYAWYSHPLTPGFNRYGIYLNFV---VH 188

  Fly   184 IIMYAYYLLSAMGPKVQKYLWWKKYITILQIVQFLI---IFVHT--LQIQFQPNCNFPKSIAALL 243
            ..||:||.|.:|..:|..::  .:.||.||||||:|   :..|.  |......||:|..|:..|.
 Worm   189 AFMYSYYFLRSMKIRVPGFI--AQAITSLQIVQFIISCAVLAHLGYLMHFTNANCDFEPSVFKLA 251

  Fly   244 TFNAGLFTYMFSAFYVANY 262
            .|....:..:|..|::.:|
 Worm   252 VFMDTTYLALFVNFFLQSY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 72/264 (27%)
elo-1NP_501689.1 ELO 39..278 CDD:279492 77/279 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.