DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and elo-5

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001368393.1 Gene:elo-5 / 177320 WormBaseID:WBGene00001243 Length:274 Species:Caenorhabditis elegans


Alignment Length:252 Identity:73/252 - (28%)
Similarity:109/252 - (43%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YMRDRKPFELKNTLLVYNAVQVLLSWVLFYEGY--------KGGWGGHYNFKCQPVTYESDPISM 113
            ||:|||.|:|...|.::|.:....|.:.|...:        |.|:...|:...:..|   |..| 
 Worm    43 YMKDRKAFDLSTPLNIWNGILSTFSLLGFLFTFPTLLSVIRKDGFSHTYSHVSELYT---DSTS- 103

  Fly   114 RMARAVWLYYIAKITELLDTVFFVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFA-------GGH 171
              ...::|:.|:||.|||||||.||||  |.:.|:|.|||.|        ..|:|       ..|
 Worm   104 --GYWIFLWVISKIPELLDTVFIVLRK--RPLIFMHWYHHAL--------TGYYALVCYHEDAVH 156

  Fly   172 GTLLGFINSFIHIIMYAYYLLSAM----GPKVQKYLWWKKYITILQIVQFLIIFVHTLQIQFQPN 232
            ...:.::|..||..||.||||.::    .|.|      .:.||..|:|||.:.....:.:.::..
 Worm   157 MVWVVWMNYIIHAFMYGYYLLKSLKVPIPPSV------AQAITTSQMVQFAVAIFAQVHVSYKHY 215

  Fly   233 CNFPKSIA------ALLTFNAGLFTYMFSAFYVANYKKE-------AAAQAKLAAKK 276
            ....:.:|      |:..|....:.|::..||..:|.|.       |..|||...||
 Worm   216 VEGVEGLAYSFRGTAIGFFMLTTYFYLWIQFYKEHYLKNGGKKYNLAKDQAKTQTKK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 65/229 (28%)
elo-5NP_001368393.1 ELO 29..258 CDD:395916 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.