DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and Elovl5

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:257 Identity:105/257 - (40%)
Similarity:149/257 - (57%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWVLFYEG 88
            |.|.|.|||.:...|.|:....|| ..::.||:||::|:||..:..|:|||....|||..:|||.
  Rat    20 DTRVKGWFLLDNYIPTFVCSAIYL-LIVWLGPKYMKNRQPFSCRGILVVYNLGLTLLSLYMFYEL 83

  Fly    89 YKGGWGGHYNFKCQPV--TYESDPISMRMARAVWLYYIAKITELLDTVFFVLRKKQRQISFLHLY 151
            ..|.|.|.|||.||..  ..|||   |::.|.:|.||.:|:.|.:||.||:|||...||:.||:|
  Rat    84 VTGVWEGKYNFFCQGTRSAGESD---MKVIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVY 145

  Fly   152 HH-TLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITILQIV 215
            || |::.:..|: :.:...||......:|||||::||:||.||:: |.::.|||||||||..|:|
  Rat   146 HHATMLNIWWFV-MNWVPCGHSYFGATLNSFIHVLMYSYYGLSSV-PSMRPYLWWKKYITQGQLV 208

  Fly   216 QFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYM------FSAFYVANYKKEAAAQAK 271
            ||::..:.|......| |:||   ...|.|..|   ||      |:.||:..|.|:.|::.|
  Rat   209 QFVLTIIQTSCGVIWP-CSFP---LGWLYFQIG---YMISLIALFTNFYIQTYNKKGASRRK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 97/239 (41%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 100/246 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.