DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and Elovl6

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_569717.1 Gene:Elovl6 / 170439 MGIID:2156528 Length:267 Species:Mus musculus


Alignment Length:277 Identity:72/277 - (25%)
Similarity:121/277 - (43%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FVEHEDLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLS-- 81
            |.|:|.:   ||...|.. ..|:....|..| ::.|...|..|..|||:..|::::....:.|  
Mouse    17 FNENEAI---QWMQENWK-KSFLFSALYAAF-IFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIF 76

  Fly    82 ----------WVLFYEGYKGGWGGHYNFKCQPV---TYESDPISMRMARAVWLYYIAKITELLDT 133
                      ::|..:|.|           |.|   ::.:.|:|...|.|   :.::|..||.||
Mouse    77 GALRTGAYMLYILMTKGLK-----------QSVCDQSFYNGPVSKFWAYA---FVLSKAPELGDT 127

  Fly   134 VFFVLRKKQRQISFLHLYHHTLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPK 198
            :|.:|||  :::.|||.|||..:.:.::...|....|.|..: .:|..:|.:||:||.|.|.|.:
Mouse   128 IFIILRK--QKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFM-TMNYGVHAVMYSYYALRAAGFR 189

  Fly   199 VQKYLWWKKYITILQIVQFLI-IFVHTLQIQFQPNCN----------FPKSIAALLTFNAGLFTY 252
            |.:.  :..:||:.||.|.|: ..::.|...:..:.|          |..|:..|...  .||.:
Mouse   190 VSRK--FAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYL--VLFCH 250

  Fly   253 MFSAFYVANYKKEAAAQ 269
            .|...|:...||...|:
Mouse   251 FFFEAYIGKVKKATKAE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 64/256 (25%)
Elovl6NP_569717.1 ELO 25..264 CDD:395916 67/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.