DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5326 and MGC115163

DIOPT Version :9

Sequence 1:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017953097.1 Gene:MGC115163 / 101732387 XenbaseID:XB-GENE-5892987 Length:277 Species:Xenopus tropicalis


Alignment Length:245 Identity:108/245 - (44%)
Similarity:144/245 - (58%) Gaps:14/245 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DLRTKQWFLSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWVLFYEG 88
            |.||..|.|..:|.|:.:|...||.. :..|||.|..|:.|.|::.||:||...|.||..:|||.
 Frog    32 DPRTDPWLLVYSPVPVILIFAVYLVL-VALGPRLMDKREAFTLRSVLLIYNLALVGLSAYMFYEF 95

  Fly    89 YKGGWGGHYNFKCQPVTYESDPISMRMARAVWLYYIAKITELLDTVFFVLRKKQRQISFLHLYHH 153
            ........|::.||||.|....:.:||||..|.::.:|:.|||||:||::|||..||||||:|||
 Frog    96 LVTSVLAGYSYLCQPVDYTDSQLGLRMARVCWWFFFSKVIELLDTIFFIMRKKFNQISFLHVYHH 160

  Fly   154 TLMPVCAFIGVKYFAGGHGTLLGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITILQIVQFL 218
            ..|....:.||||.|||....:|.:|||:||.||.||.|:.:|||||||||||:|:|:||:.||.
 Frog   161 ATMIFNWWAGVKYVAGGQAFFIGMLNSFVHIFMYLYYGLAVLGPKVQKYLWWKRYLTLLQLTQFG 225

  Fly   219 IIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTY------MFSAFYVANY 262
            .|.:|: ......:|.||..      |||.:|.|      :|..||...|
 Frog   226 AIALHS-GYNLVTDCPFPDG------FNAAVFAYIVSLIILFLNFYYQTY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5326NP_651060.1 ELO 31..262 CDD:395916 103/236 (44%)
MGC115163XP_017953097.1 ELO 40..276 CDD:366492 104/237 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.