DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G80320

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_178148.1 Gene:AT1G80320 / 844372 AraportID:AT1G80320 Length:320 Species:Arabidopsis thaliana


Alignment Length:334 Identity:70/334 - (20%)
Similarity:134/334 - (40%) Gaps:67/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QNAVPIIDLEN------------TIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFV 63
            :..:||:|..:            |.:||    |.|:..:|:.:....|:|::.............
plant     6 EQCLPILDFSSDKLVRGTSHWITTRDDV----RRAMEGQGWFVAEFSGVSSDLRDNLLAGMKEMY 66

  Fly    64 DLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPE---LRHAYNI--CKLQDKFLPEQQLPGF 123
            .|.|::|:..|..||    :|||:|..::  |.|..|   :.:|..:  ||...|.|..|....|
plant    67 YLPDQIKIKNENHKA----SHGYMSMVVD--DYRIHESLGIDYATELQACKDFSKLLWPQGNDPF 125

  Fly   124 SRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDHG 188
            .:..:.......||.:.:::.|.      .|:..|:....:|........||||.|...::.:..
plant   126 CQTTHMYAMTMAELDQTVMRMLY------ESYGMDEKKHSVSHSESTRYLLRMLSYRRQQNGEAN 184

  Fly   189 RSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHAL 253
            ..|:   :|.|....::|.|:..|||::|.. :.:|......|....:..|..:..|::....|.
plant   185 TGFV---SHTDKSFMSILHQNHVGGLQLKTM-TGQWVGFNPSPTRFVVLSGMGLTAWSNDRIKAC 245

  Fly   254 QHRVVI-PDQVDIRHRGRHSIAYFC----------------HP------DNSALINPKDLNITT- 294
            .|:||: .|::      |:|:.:|.                ||      ::..|:...:..|.: 
plant   246 YHKVVMSADEI------RYSLGFFSFHKGTIRTPEELVDDQHPLRYNPFEHDGLLRFYESYINSL 304

  Fly   295 KQTTSDVIQ 303
            |:::.|::|
plant   305 KKSSEDLLQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 66/313 (21%)
DIOX_N 14..107 CDD:290926 25/107 (23%)
2OG-FeII_Oxy 179..279 CDD:281202 22/116 (19%)
AT1G80320NP_178148.1 PLN02365 33..295 CDD:177993 61/287 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.