DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G77330

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_565154.1 Gene:AT1G77330 / 844069 AraportID:AT1G77330 Length:307 Species:Arabidopsis thaliana


Alignment Length:308 Identity:79/308 - (25%)
Similarity:120/308 - (38%) Gaps:78/308 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVPIIDL--------ENTIEDVATNLREALSEKGYALLINHGISNE---KIKK------------ 54
            |:|:||.        |.|:.::|    .|..|.|:..|:||||..|   |:||            
plant     2 AIPVIDFSKLNGEEREKTLSEIA----RACEEWGFFQLVNHGIPLELLNKVKKLSSDCYKTEREE 62

  Fly    55 AWKYFDGFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKF-LPEQ 118
            |:|       .::.|||..|..:...||.       :|..|              .:|.| |.:.
plant    63 AFK-------TSNPVKLLNELVQKNSGEK-------LENVD--------------WEDVFTLLDH 99

  Fly   119 QLPGFSRHINSLVDDFNE----LGRFILKALAISLDAPPSFFTDKHSF---MLSDDRFNLTTLRM 176
            ....:..:|...:.::.|    |...:::.:..:|..|..:.  |.:|   |...:.......::
plant   100 NQNEWPSNIKETMGEYREEVRKLASKMMEVMDENLGLPKGYI--KKAFNEGMEDGEETAFFGTKV 162

  Fly   177 LFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPGALFINCGE 240
            ..|||.   .|........||.|.....||.||.| .||:|...|  :|..|..||.|:.||.|:
plant   163 SHYPPC---PHPELVNGLRAHTDAGGVVLLFQDDEYDGLQVLKDG--EWIDVQPLPNAIVINTGD 222

  Fly   241 TMAIWTDQFYHALQHRVVIPDQVDIRHRG-RHSIAYFCHPDNSALINP 287
            .:.:.::..|.:..|||:      .|..| |.|||.|.:|...|.|.|
plant   223 QIEVLSNGRYKSAWHRVL------AREEGNRRSIASFYNPSYKAAIGP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 78/306 (25%)
DIOX_N 14..107 CDD:290926 28/115 (24%)
2OG-FeII_Oxy 179..279 CDD:281202 35/101 (35%)
AT1G77330NP_565154.1 PLN02299 1..307 CDD:215168 79/308 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.