DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G55290

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_175925.1 Gene:AT1G55290 / 841974 AraportID:AT1G55290 Length:361 Species:Arabidopsis thaliana


Alignment Length:307 Identity:80/307 - (26%)
Similarity:131/307 - (42%) Gaps:55/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVPIIDLENTIE-DVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLAFERS 76
            ::|:||:.|..| .|:..:.:|..|.|:..:||||:|.|.::........|..|..|.|..|.|.
plant    61 SIPVIDISNLDEKSVSKAVCDAAEEWGFFQVINHGVSMEVLENMKTATHRFFGLPVEEKRKFSRE 125

  Fly    77 KAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDK----FLPE----QQLPGFSR-----HIN 128
            |:        :|..:......:|   ||....:.:|.    |:.|    |..|...|     ::|
plant   126 KS--------LSTNVRFGTSFSP---HAEKALEWKDYLSLFFVSEAEASQLWPDSCRSETLEYMN 179

  Fly   129 SLVDDFNELGRFILKALAI-SLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDHGRSFI 192
            .......:|.||:.:.|.: .||      ..|.||.:...|.||.     :||...:.:   ..:
plant   180 ETKPLVKKLLRFLGENLNVKELD------KTKESFFMGSTRINLN-----YYPICPNPE---LTV 230

  Fly   193 RCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHALQHRV 257
            ..|.|:|..:.|:|.||..|||.|:...:.:|..|..:.|:|.||.|:.|.|.::..|.:::|||
plant   231 GVGRHSDVSSLTILLQDEIGGLHVRSLTTGRWVHVPPISGSLVINIGDAMQIMSNGRYKSVEHRV 295

  Fly   258 VIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNITTKQTTSDVIQN 304
            :.....:     |.|:..|..|...::|.|          ..:||:|
plant   296 LANGSYN-----RISVPIFVSPKPESVIGP----------LLEVIEN 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 76/288 (26%)
DIOX_N 14..107 CDD:290926 26/93 (28%)
2OG-FeII_Oxy 179..279 CDD:281202 29/99 (29%)
AT1G55290NP_175925.1 PLN03178 26..361 CDD:215614 80/307 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
66.010

Return to query results.
Submit another query.