DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G52810

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_175690.1 Gene:AT1G52810 / 841714 AraportID:AT1G52810 Length:289 Species:Arabidopsis thaliana


Alignment Length:313 Identity:73/313 - (23%)
Similarity:111/313 - (35%) Gaps:86/313 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSETETLLLQNAVPIIDLEN------TI--EDVATNLREALSEKGYALLINHGISNEKIKKAWK 57
            |.|...||.||  :|:||..:      ||  :.|..::|.||.|.|....:...:..| ::||  
plant     1 MVSLETTLALQ--LPVIDFTSRDLKPGTIQWDSVRADVRRALEEYGCFEALFDKVPLE-LRKA-- 60

  Fly    58 YFDGFVDLTDEV-KLAFERSK--APDGENHGYVS--PGMERFD------GRTPELRHAYNICKLQ 111
                ..|.::|| :|..|..|  ....:..|||.  |.:..|:      ...|:..:|:.     
plant    61 ----VFDASEEVFQLPLETKKRVVSKRKYRGYVGQIPTLPLFEVMGVDFAENPDKVNAFT----- 116

  Fly   112 DKFLPEQQLPGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRM 176
            .|..| |....||..:.|..:..:||                       .||         |.||
plant   117 HKLWP-QGNNNFSEAVMSFAEKVSEL-----------------------DFM---------TRRM 148

  Fly   177 LFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGET 241
            :    :|......|:|:     ::...|....|.:.|:|||.:....|.:......:.||..|..
plant   149 I----MESFGLDESYIK-----EHLNSTKCLNDVKDGIEVKTKDDKHWIKANPSQDSSFIVLGGA 204

  Fly   242 MAIWTDQFYHALQHRVVIPDQVDIRHRG---RHSIAYFCHPDNSALI-NPKDL 290
            |       .|||.:..|:.....:...|   |.|...|..|....|| .|::|
plant   205 M-------LHALLNGRVLTGVHRVMRMGANIRFSAGLFSVPKTEDLIYAPEEL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 65/296 (22%)
DIOX_N 14..107 CDD:290926 27/111 (24%)
2OG-FeII_Oxy 179..279 CDD:281202 22/102 (22%)
AT1G52810NP_175690.1 PLN02365 12..267 CDD:177993 67/300 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.