DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G52800

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_175689.1 Gene:AT1G52800 / 841713 AraportID:AT1G52800 Length:314 Species:Arabidopsis thaliana


Alignment Length:342 Identity:69/342 - (20%)
Similarity:122/342 - (35%) Gaps:88/342 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLLLQNAVPIIDL---------ENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGF 62
            ::|....|||:||         .:|...|:....|||.|.|..|.:..|::.:.....:...:..
plant     3 SILKTTKVPILDLTSQQELKPNTSTWRSVSREACEALEEYGCFLAVYDGVTQQLDDSIFAAAEEL 67

  Fly    63 VDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTP--ELRHAYNICKLQDKFLPE-------- 117
            .||..|.|    :....:...||||        |:.|  .|.....:..:.:|.:.:        
plant    68 FDLPTETK----KKNVNEKPYHGYV--------GQMPVIPLHEGLGVDYVTNKEIAQRFTHLMWP 120

  Fly   118 QQLPGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKH-SFMLSDDRFNLTTLRMLFYP- 180
            |....|...:::..:...||.|.:::.:.      .::..:|| ...:....:.|..|:.|..| 
plant   121 QGNDRFCNTVHTFSNAVAELDRLVVRMIF------ENYGVEKHYESHVGSKTYLLKFLKYLAPPE 179

  Fly   181 ----PVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGET 241
                |...|           |.|....::|.|:...|||||.:..: |..:...|.:..:..|:.
plant   180 SISMPAFPQ-----------HTDKTFLSILHQNDVNGLEVKSKDGE-WISLQLPPKSYVVMAGDI 232

  Fly   242 MAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFC----------------HP------DNSAL 284
            ...|::....:.:|||.:...     :.|:::..|.                ||      ||.||
plant   233 SMGWSNDRIRSCEHRVTMEGD-----KTRYTLGLFSFLTDLVSIPEELVDDKHPLMYKPFDNIAL 292

  Fly   285 IN------PKDLNITTK 295
            ||      .::.|.|.|
plant   293 INFYTTKEGREANSTLK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 65/326 (20%)
DIOX_N 14..107 CDD:290926 25/103 (24%)
2OG-FeII_Oxy 179..279 CDD:281202 21/120 (18%)
AT1G52800NP_175689.1 PLN02365 33..287 CDD:177993 52/288 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.