DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G52790

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_175688.1 Gene:AT1G52790 / 841712 AraportID:AT1G52790 Length:310 Species:Arabidopsis thaliana


Alignment Length:313 Identity:61/313 - (19%)
Similarity:109/313 - (34%) Gaps:110/313 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLAFERSKAPDGENHGYVS 88
            |....|:|:||.|.|..:                     :||.|:..|..               
plant    23 ESTRENIRQALEEYGCFI---------------------IDLKDKTPLDL--------------- 51

  Fly    89 PGMERFDGRTPELRHAYNICKLQDKFLPEQQLPGFSRHINSL-------VDDFNELGRFILKALA 146
              ::|..|...:|.......|:::|:  ::.|.|:...|.:|       :|:            |
plant    52 --LDRVFGSLVDLFDLPTQTKMKNKY--DKPLNGYVGQIPALPLHESLGIDN------------A 100

  Fly   147 ISLDAPPSF---------------------FTDKHSFMLS-------------DDRFNLTT--LR 175
            .||:|..||                     |..:...|::             |.....||  ||
plant   101 TSLEATRSFTGLMWPQGNEHFSECLYKYAEFAAELDQMVTRMVFQSYNVEKYYDPYIESTTYLLR 165

  Fly   176 MLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVG---HLPGALFIN 237
            :|......:::....|:   .|.|....|:|.||...|||::.|   :.||:.   ..|....:.
plant   166 VLKNRAPNNENPTLGFV---THTDKSFTTILHQDQVNGLEMETR---EGERININLSSPSLFMVV 224

  Fly   238 CGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDL 290
            .|:.:..|::....:.:|:|::..:.|     |:|:..|.. :|..|..|::|
plant   225 AGDALMAWSNDRVWSPRHQVLVSGETD-----RYSLGMFAF-NNGTLQVPEEL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 59/308 (19%)
DIOX_N 14..107 CDD:290926 14/82 (17%)
2OG-FeII_Oxy 179..279 CDD:281202 22/102 (22%)
AT1G52790NP_175688.1 PLN02365 5..297 CDD:177993 61/313 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.