DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and GA2OX7

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_175509.1 Gene:GA2OX7 / 841518 AraportID:AT1G50960 Length:336 Species:Arabidopsis thaliana


Alignment Length:297 Identity:67/297 - (22%)
Similarity:121/297 - (40%) Gaps:49/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSETETLLLQNA---VPIIDLENTI--EDV-----ATNLREALSEKGYALLINHGISNEKIKKAW 56
            :|.|.|..:|.:   :|:|||.:..  |:|     ...:..|..|.|:..::||||..:..:   
plant    25 ESNTNTSTIQTSGIKLPVIDLSHLTSGEEVKRKRCVKQMVAAAKEWGFFQIVNHGIPKDVFE--- 86

  Fly    57 KYFDGFVDLTDEVKLAFERSKAPDGENHGYVSPGMERFDGRTPELRHAYNICKLQDKFLPEQQLP 121
                  :.|.:|.||..:.......|....:|....|:...:......|::.:.....|.|....
plant    87 ------MMLLEEKKLFDQPFSVKVRERFSDLSKNSYRWGNPSATSPAQYSVSEAFHIILSEVSRI 145

  Fly   122 GFSRH-----INSLVDDFNELGRFILKALAISLDAPPSFFTD----KHSFMLSDDRFNLTTLRML 177
            ...|:     :.:.|.:...:.:.|.:.|...::....:|.:    ::||:    |.|      .
plant   146 SDDRNNLRTIVETYVQEIARVAQMICEILGKQVNVSSEYFENIFELENSFL----RLN------K 200

  Fly   178 FYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETM 242
            ::|.|    .|........|.|....|:|:||..||||::..|  :|..|.....||.:|.|:..
plant   201 YHPSV----FGSEVFGLVPHTDTSFLTILSQDQIGGLELENNG--QWISVKPCLEALTVNIGDMF 259

  Fly   243 AIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHP 279
            ...::..|.:::|||:.|..::     |.|||:|..|
plant   260 QALSNGVYQSVRHRVISPANIE-----RMSIAFFVCP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 63/286 (22%)
DIOX_N 14..107 CDD:290926 21/99 (21%)
2OG-FeII_Oxy 179..279 CDD:281202 30/99 (30%)
GA2OX7NP_175509.1 PLN02984 3..336 CDD:215534 67/297 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.910

Return to query results.
Submit another query.