DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G49390

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_175364.1 Gene:AT1G49390 / 841362 AraportID:AT1G49390 Length:348 Species:Arabidopsis thaliana


Alignment Length:318 Identity:88/318 - (27%)
Similarity:131/318 - (41%) Gaps:60/318 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ETETLLLQNAVPIIDL---------ENTI--EDVATNLREALSEKGYALLINHGISNEKIKKAWK 57
            |.|:..|..|||.:|:         .:::  ::....|..|||..|...::||||:...:.|.:|
plant    30 EGESQPLNGAVPEMDIPAIDLSLLFSSSVDGQEEMKKLHSALSTWGVVQVMNHGITEAFLDKIYK 94

  Fly    58 YFDGFVDLTDEVKLAFERSKAPDGENHGY----------VSPGMERFDGRTPELRHAYNICKLQD 112
            ....|..|..|.|   .:.....|...||          |...::|....|      |...|.|.
plant    95 LTKQFFALPTEEK---HKCARETGNIQGYGNDMILSDNQVLDWIDRLFLTT------YPEDKRQL 150

  Fly   113 KFLPEQQLP-GFSRHINSLVDDFNELGRFIL----KALAISLDAPPSFFTDKH-SFMLSDDRFNL 171
            ||.|  |:| |||    ..:|::....|.::    ||:|.||:...:.|.:.: ...:.:.||| 
plant   151 KFWP--QVPVGFS----ETLDEYTMKQRVLIEKFFKAMARSLELEENCFLEMYGENAVMNSRFN- 208

  Fly   172 TTLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSE-GGLEVKLRGSDKWERVGHLPGALF 235
                  |:||....|   ..|....|||....|||..|.: .||:....|  ||.:...:|..:.
plant   209 ------FFPPCPRPD---KVIGIKPHADGSAITLLLPDKDVEGLQFLKDG--KWYKAPIVPDTIL 262

  Fly   236 INCGETMAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINPKDLNIT 293
            |..|:.|.|.::..|.:..||||..     |.:.|.|:|.||.|.....|:|.|..:|
plant   263 ITLGDQMEIMSNGIYKSPVHRVVTN-----REKERISVATFCVPGLDKEIHPADGLVT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 82/301 (27%)
DIOX_N 14..107 CDD:290926 25/113 (22%)
2OG-FeII_Oxy 179..279 CDD:281202 32/100 (32%)
AT1G49390NP_175364.1 PLN00417 1..348 CDD:177810 88/318 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.910

Return to query results.
Submit another query.