DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and GA20OX5

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_175075.1 Gene:GA20OX5 / 841012 AraportID:AT1G44090 Length:385 Species:Arabidopsis thaliana


Alignment Length:305 Identity:79/305 - (25%)
Similarity:119/305 - (39%) Gaps:59/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VPIIDL-------ENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKL 71
            :|||||       |...:..|..:::|....|..|::|||..:...:||.:....|..|:.:.||
plant    63 LPIIDLSGFLNGNEAETQLAAKAVKKACMAHGTFLVVNHGFKSGLAEKALEISSLFFGLSKDEKL 127

  Fly    72 AFERSKAPDGENHGYVSPGMERFDGRTP-----ELRHAYNICKLQDKFLPE----------QQLP 121
               |:....|...||.:...:||....|     .|........:.:.||..          |...
plant   128 ---RAYRIPGNISGYTAGHSQRFSSNLPWNETLTLAFKKGPPHVVEDFLTSRLGNHRQEIGQVFQ 189

  Fly   122 GFSRHINSLVDDFNELGRFILKALAISLDAPP-----SFFTDKHSFMLSDDRFNLTTLRMLFYPP 181
            .|...:|.||.|..||       |.||:....     .||.|....           .|..:|||
plant   190 EFCDAMNGLVMDLMEL-------LGISMGLKDRTYYRRFFEDGSGI-----------FRCNYYPP 236

  Fly   182 VEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWT 246
            .:..:..   :..|.|.|....|:|.||...||||...||  |:.|...||||.:|.|:|....:
plant   237 CKQPEKA---LGVGPHNDPTAITVLLQDDVVGLEVFAAGS--WQTVRPRPGALVVNVGDTFMALS 296

  Fly   247 DQFYHALQHRVVIPDQVDIRHRGRHSIAYF-CHPDNSALINPKDL 290
            :..|.:..||.|:.     :.:.|.|:.:| |..::..::.|.:|
plant   297 NGNYRSCYHRAVVN-----KEKVRRSLVFFSCPREDKIIVPPPEL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 77/300 (26%)
DIOX_N 14..107 CDD:290926 27/104 (26%)
2OG-FeII_Oxy 179..279 CDD:281202 33/100 (33%)
GA20OX5NP_175075.1 PLN02276 24..383 CDD:215156 79/305 (26%)
DIOX_N 63..160 CDD:290926 26/99 (26%)
2OG-FeII_Oxy 228..324 CDD:281202 33/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D622449at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.