DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and GA2OX2

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_174296.1 Gene:GA2OX2 / 839883 AraportID:AT1G30040 Length:341 Species:Arabidopsis thaliana


Alignment Length:294 Identity:71/294 - (24%)
Similarity:130/294 - (44%) Gaps:41/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLQNAVPIIDLENTIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLA 72
            :|..:::|:::|.:  .:..|.:.:|..|.|:..::|||:..|.:.:..:...||..|...:|  
plant    25 VLTSHSIPVVNLAD--PEAKTRIVKACEEFGFFKVVNHGVRPELMTRLEQEAIGFFGLPQSLK-- 85

  Fly    73 FERSKAPDGENHGYVSPGMERFD-------------GRTPELRHAYNICKLQDKFLPEQQLPGFS 124
               ::|...|.:||   |.:|..             ...|:|...    |....|....|:  |.
plant    86 ---NRAGPPEPYGY---GNKRIGPNGDVGWIEYLLLNANPQLSSP----KTSAVFRQTPQI--FR 138

  Fly   125 RHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDHGR 189
            ..:...:.:..|:...:|:.:|..|...|   .|..|.||.|::.: :.||:..||..|::....
plant   139 ESVEEYMKEIKEVSYKVLEMVAEELGIEP---RDTLSKMLRDEKSD-SCLRLNHYPAAEEEAEKM 199

  Fly   190 SFIRCGAHADYCTFTLLAQDSEGGLEVKLR-GSDKWERVGHLPGALFINCGETMAIWTDQFYHAL 253
            ..:..|.|.|....::|..::..||::.:: ||  |..|.....:.|||.|:.:.:.|:..:.::
plant   200 VKVGFGEHTDPQIISVLRSNNTAGLQICVKDGS--WVAVPPDHSSFFINVGDALQVMTNGRFKSV 262

  Fly   254 QHRVVIPDQVDIRHRGRHSIAYFCHPDNSALINP 287
            :|||:    .|.| |.|.|:.||..|..|..|.|
plant   263 KHRVL----ADTR-RSRISMIYFGGPPLSQKIAP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 69/287 (24%)
DIOX_N 14..107 CDD:290926 22/105 (21%)
2OG-FeII_Oxy 179..279 CDD:281202 28/100 (28%)
GA2OX2NP_174296.1 PLN02156 1..340 CDD:177816 71/294 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X166
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.910

Return to query results.
Submit another query.