DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G28030

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_174124.1 Gene:AT1G28030 / 839696 AraportID:AT1G28030 Length:322 Species:Arabidopsis thaliana


Alignment Length:310 Identity:75/310 - (24%)
Similarity:127/310 - (40%) Gaps:49/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSETETLLLQNAVPIIDLEN--------TIEDVATNLREALSEKGYALLINHGISNEKIKKAWK 57
            :.||::..|   ::||||..|        ..:.|.:.:|:||.|.|....:..|.|.|..|..::
plant     3 ISSESQVPL---SLPIIDFSNPDLKPETPEWDLVRSQVRKALEEYGCFEALFDGASMELRKALFE 64

  Fly    58 YFDGFVDLTDEVKLAFERSKAPDGENHGY-------VSPGMERFDGRTPELRHAYNICKLQDKFL 115
            ......||..|.||    |...|....||       :..||..:....|.:     :..|..|..
plant    65 SSKEVFDLPLETKL----STKTDVHYEGYLTIPRVPIQEGMGFYGIDNPNV-----VNDLTHKLW 120

  Fly   116 PEQQLPGFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTT--LRMLF 178
            |:..: ...:::.|..:...||.   |....::|:   ||..:|:    .::..|...  .::|.
plant   121 PQGNI-FVGKNVQSFAEKLIELN---LTVRTMTLE---SFGLEKY----MEEHLNAANKHFQLLK 174

  Fly   179 YPPVEDQDHGRSFIRCGAHADYCTFTLLAQ-DSEGGLEVKLRGSDKWERVGHLPGALFI-NCGET 241
            |..:.| |:..:.|....|.|....|:|.| |:..|||:|.:..::|.:|.....:.|| ..|.:
plant   175 YKGISD-DNTENKIGFYPHIDRHFLTILCQNDAVDGLEIKTKDGEEWIKVKPSQASSFIVMAGAS 238

  Fly   242 MAIWTDQFYHALQHRVVIPDQVDIRHRGRHSIAYFCHPDNSALIN-PKDL 290
            :.:..:.......|||||..:.|     |:..|.|..|....:|| |:::
plant   239 LHVLLNGGVFPPLHRVVITGKKD-----RYVAALFTIPKEGVIINAPEEM 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 71/293 (24%)
DIOX_N 14..107 CDD:290926 27/107 (25%)
2OG-FeII_Oxy 179..279 CDD:281202 28/101 (28%)
AT1G28030NP_174124.1 PLN02947 10..303 CDD:215510 73/303 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.