DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and AT1G04350

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_171930.1 Gene:AT1G04350 / 839542 AraportID:AT1G04350 Length:360 Species:Arabidopsis thaliana


Alignment Length:366 Identity:83/366 - (22%)
Similarity:132/366 - (36%) Gaps:121/366 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVPIIDLEN---TIEDVATNLREALSEKGYALLINHGISNEKIKKAWKYFDGFVDLTDEVKLAFE 74
            |:||||.|.   :.||:...:::|.|..|:..:||||:....:::                    
plant    57 AIPIIDFEGLHVSREDIVGKIKDAASNWGFFQVINHGVPLNVLQE-------------------- 101

  Fly    75 RSKAPDGENHGYVSPGMERFDGRTPELRHAY---------------------NICKLQDKF---- 114
                        :..|:.||....||::..|                     :....:|.|    
plant   102 ------------IQDGVRRFHEEAPEVKKTYFTRDATKRFVYNSNFDLYSSSSCVNWRDSFACYM 154

  Fly   115 LPE----QQLP--------GFSRHINSLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDD 167
            .|:    :.||        .:|:|:..|.|...||   :.:||.:..|...|....|...:|.. 
plant   155 APDPPNPEDLPVACRVAMFEYSKHMMRLGDLLFEL---LSEALGLRSDKLKSMDCMKGLLLLCH- 215

  Fly   168 RFNLTTLRMLFYPPVEDQDHGRSFIRCGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPG 232
                      :|||....|   ..|....|:|....|:|.||..|||::  ...|.|..|..:||
plant   216 ----------YYPPCPQPD---LTIGTNNHSDNSFLTILLQDQIGGLQI--FHQDCWVDVSPIPG 265

  Fly   233 ALFINCGETMAIWTDQFYHALQHRVVIPDQVDIRHRG---RHSIAYFCHPD---NSALINP-KDL 290
            ||.||.|:.:.:.|:....:::|||       :.:|.   |.|:|.|....   ||.:..| |:|
plant   266 ALVINMGDFLQLITNDKVISVEHRV-------LANRAATPRISVASFFSTSMRPNSTVYGPIKEL 323

  Fly   291 ----------NITTKQTTSDVIQNAYDITMALAKGAFAHHY 321
                      .|..|:.|....:...|.|      ::..||
plant   324 LSEENPSKYRVIDLKEYTEGYFKKGLDGT------SYLSHY 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 73/319 (23%)
DIOX_N 14..107 CDD:290926 20/116 (17%)
2OG-FeII_Oxy 179..279 CDD:281202 33/102 (32%)
AT1G04350NP_171930.1 PLN02947 21..337 CDD:215510 77/337 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2188
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10209
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
55.010

Return to query results.
Submit another query.