DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33093 and GA2OX6

DIOPT Version :9

Sequence 1:NP_788715.2 Gene:CG33093 / 42654 FlyBaseID:FBgn0053093 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_171742.1 Gene:GA2OX6 / 839508 AraportID:AT1G02400 Length:329 Species:Arabidopsis thaliana


Alignment Length:289 Identity:75/289 - (25%)
Similarity:116/289 - (40%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PIIDLENTIEDVATNLREALSEK--------GYALLINHGISNEKIKKAWKYFDGFVDLTDEVKL 71
            |:||.       :.|.|..||||        |:..:||||:..|.||:.....:.|.:..:..||
plant    25 PVIDF-------SLNDRSKLSEKIVKACEVNGFFKVINHGVKPEIIKRFEHEGEEFFNKPESDKL 82

  Fly    72 AFERSKAPDGENHGYVSPGMER--FDGRTPELR----HAYNICKLQDK--FLPEQQLPGFSRHIN 128
                 :|......||   |.:.  |:|...||.    || |...:.||  .:.......||...|
plant    83 -----RAGPASPFGY---GCKNIGFNGDLGELEYLLLHA-NPTAVADKSETISHDDPFKFSSATN 138

  Fly   129 SLVDDFNELGRFILKALAISLDAPPSFFTDKHSFMLSDDRFNLTTLRMLFYPPVEDQDHGRSFIR 193
            ..:....:|...|:.....:|....|   .:.|.::.|.|.: :.||:..|||......|...|.
plant   139 DYIRTVRDLACEIIDLTIENLWGQKS---SEVSELIRDVRSD-SILRLNHYPPAPYALSGVGQIG 199

  Fly   194 CGAHADYCTFTLLAQDSEGGLEVKLRGSDKWERVGHLPGALFINCGETMAIWTDQFYHALQHRVV 258
            .|.|:|....|:|..:...|||:..| ...|..:...|...|:..|:.:...|:..:.:::|||:
plant   200 FGEHSDPQILTVLRSNDVDGLEICSR-DGLWIPIPSDPTCFFVLVGDCLQALTNGRFTSVRHRVL 263

  Fly   259 IPDQVDIRHRGRHSIAYFCHPDNSALINP 287
                .:...:.|.|..||..|...|.|:|
plant   264 ----ANTAKKPRMSAMYFAAPPLEAKISP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33093NP_788715.2 PcbC 13..287 CDD:226022 74/287 (26%)
DIOX_N 14..107 CDD:290926 30/105 (29%)
2OG-FeII_Oxy 179..279 CDD:281202 26/99 (26%)
GA2OX6NP_171742.1 PLN02156 25..327 CDD:177816 75/289 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3647
eggNOG 1 0.900 - - E1_COG3491
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.860

Return to query results.
Submit another query.